Axial Commons Image Treasury
Gravura de um jovem mostrando uma caixa óptica a crianças e adultos diante de uma casa de madeira, com trepadeira e cerca ao fundo.

A curiosidade: showman com caixa óptica e público reunido

Uma gravura mostra um jovem itinerante de chapéu de abas largas debruçado sobre uma alta caixa óptica ao lado de uma construção de madeira, enquanto crianças e adultos se reúnem para olhar. Uma trepadeira florida sombreia a cena, com cerca e barril em primeiro plano.

Artista
Brakenburg, Richard, 1650-1702.
Data
[1752]
Técnica
Engravings
Fonte
Wellcome Collection
Tamanho
4000 × 3552 px
Baixar em tamanho original
Domínio público · Wellcome Collection marks it Public Domain Mark; made by 1752.
Direitos verificados 2026-11-05 · nível A · conforme a fonte: Public Domain Mark (Wellcome Collection)

Crédito (bem-vindo, não obrigatório em obras de domínio público): Wellcome Collection

A vida de Cristo18th centuryengravingetchingprintmakinggenre scenevillage scenemagic lantern show

Mais de A vida de Cristo

Christ as Salvator Mundi. Process print after J. Lafarge, 1899.Christ as Salvator Mundi. Process print after J. Lafarge, 1899.Lamentation of ChristLamentation of ChristChristus verschijnt aan Maria Magdalena als hovenierChristus verschijnt aan Maria Magdalena als hovenierThe flight into Egypt in the night, illuminated by the moon and the milky way. Engraving by H. Goudt, 1613, after A. Elsheimer, 1609.The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving bSaint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. Strange after G. Reni.Saint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. StranHead of ChristHead of Christ