Axial Commons Image Treasury
Engraving of a young man showing a peep box to children and adults outside a wooden building, with a vine-covered porch and fence behind.

La Curiosité: itinerant showman with a peep box and gathered crowd

An engraving shows a young showman in a broad-brimmed hat leaning over a tall peep box beside a timber building, while children and adults crowd close to look. A flowering vine shades the scene, with a fence and a barrel in the foreground.

Artist
Brakenburg, Richard, 1650-1702.
Date
[1752]
Medium
Engravings
Source
Wellcome Collection
Size
4000 × 3552 px
Download full size
Public domain · Wellcome Collection marks it Public Domain Mark; made by 1752.
Rights checked 2026-11-05 · tier A · as stated by the source: Public Domain Mark (Wellcome Collection)

Credit (appreciated, not required for public-domain works): Wellcome Collection

The Life of Christ18th centuryengravingetchingprintmakinggenre scenevillage scenemagic lantern show

More from The Life of Christ

Christ as Salvator Mundi. Process print after J. Lafarge, 1899.Christ as Salvator Mundi. Process print after J. Lafarge, 1899.Lamentation of ChristLamentation of ChristChristus verschijnt aan Maria Magdalena als hovenierChristus verschijnt aan Maria Magdalena als hovenierThe flight into Egypt in the night, illuminated by the moon and the milky way. Engraving by H. Goudt, 1613, after A. Elsheimer, 1609.The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving bSaint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. Strange after G. Reni.Saint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. StranHead of ChristHead of Christ