Axial Commons Image Treasury
Gravura de interior com mulheres e meninas em trajes do século XVIII junto a uma mesa, e uma criança segurada por uma mulher perto de uma parede com painéis.

Passatempos matinais da Princesa Real e suas irmãs

Uma gravura de interior mostra uma mulher de vestido branco e toucado de penas sentada a uma mesa com três meninas, e uma mulher em pé que segura uma criança pequena. Linhas finas de hachura modelam os vestidos drapeados e o candelabro de parede, e uma legenda impressa na borda inferior traz a data 1777.

Artista
William Blake
Data
1782
Técnica
Fonte
Wikimedia Commons / Wikidata
Tamanho
3798 × 3233 px
Baixar em tamanho original
Domínio público · William Blake died 1827 and the work dates by 1782; public domain in the US and life+70 countries.
Direitos verificados 2026-11-05 · nível B · conforme a fonte: CC0

Crédito (bem-vindo, não obrigatório em obras de domínio público): William Blake, via Wikimedia Commons (CC0)

William Blake18th centuryengravingprintetchingprintmakinggenre scenechildrenfeathered headdresstable scenefamily interiorwilliam blake

Mais de William Blake

The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."