Axial Commons Image Treasury
Engraved interior scene of women and girls in 18th-century dress at a table, with a child held by a standing woman beside a paneled wall.

The Morning Amusements of Her Royal Highness the Princess Royal and Her Sisters

An engraved interior shows a woman in a white gown and feathered headdress seated at a table with three girls, and a standing woman who holds a small child. Fine hatched lines model the draped dresses and wall sconce, and a printed caption along the bottom edge carries the date 1777.

Artist
William Blake
Date
1782
Medium
Source
Wikimedia Commons / Wikidata
Size
3798 × 3233 px
Download full size
Public domain · William Blake died 1827 and the work dates by 1782; public domain in the US and life+70 countries.
Rights checked 2026-11-05 · tier B · as stated by the source: CC0

Credit (appreciated, not required for public-domain works): William Blake, via Wikimedia Commons (CC0)

William Blake18th centuryengravingprintetchingprintmakinggenre scenechildrenfeathered headdresstable scenefamily interiorwilliam blake

More from William Blake

The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 111, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 107, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 33, "A Long Story."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 41, "The Progress of Poesy."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 115, "Elegy Written in a Country Church-Yard."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."The Poems of Thomas Gray, Design 9, "Ode on the Death of a Favourite Cat."