Axial Commons Image Treasury
Woodcut in a black border showing horned devils and hatted witches holding hands in a ring, dancing.

Witches and Devils Dancing in a Circle, Woodcut, 1720

A black-and-white woodcut framed by a ruled border shows five horned devilish figures alternating with robed, hat-wearing witches who join hands in a ring. Fine hatched lines shade the ground and the figures' clothing. The scene is crowded and energetic, with the dancers spread across the whole frame.

Artist
Unknown
Date
1720
Medium
Woodcuts
Source
Wellcome Collection
Size
4000 × 3453 px
Download full size
Public domain · Wellcome Collection marks it Public Domain Mark; made by 1720.
Rights checked 2026-11-05 · tier A · as stated by the source: Public Domain Mark (Wellcome Collection)

Credit (appreciated, not required for public-domain works): Wellcome Collection

The Life of ChristGods and Epics of India18th century1720s1720engravingwoodcutearly modern printdevilwitchcraftwitchesdemonologyhorned devildancingfolk magicblack and white

More from The Life of Christ

The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving by H. Goudt, 1613, after A. Elsheimer, 1609.The flight into Egypt in the night, illuminated by the moon and the milky way. Engraving bSaint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. Strange after G. Reni.Saint Mary (the Blessed Virgin) with the sleeping Christ Child. Line engraving by R. StranHead of ChristHead of ChristInnocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; Justice looks down from above. Etching by C. Murer after himself, c. 1600-1614.Innocence attacked from four corners by "Iudex", "Persequutiō", "Avaritia" and "Invidia"; De Heilige FamilieDe Heilige FamilieThe mocking of Christ. Etching by A. van Dyck.The mocking of Christ. Etching by A. van Dyck.