Axial Commons Image Treasury
Circular engraving labeled October showing workers treading grapes in a wooden tub, barrels at left, a village with towers and a cart in the background.

October: grape treading in a village landscape

An engraved roundel labeled OCTOBER shows people treading grapes in a large wooden tub while others work beside barrels near a thatched shed. A village with towers, a horse-drawn cart and a wooded landscape fill the background.

Artist
Adriaen Collaert
Date
1578-1582
Medium
Source
Rijksmuseum
Size
4000 × 3991 px
Download full size
Public domain · Rijksmuseum marks it Public Domain Mark; made by 1582.
Rights checked 2026-11-05 · tier A · as stated by the source: Public Domain Mark (Rijksmuseum, image license https://creativecommons.org/publicdomain/mark/1.0/)

Credit (appreciated, not required for public-domain works): Rijksmuseum, Amsterdam

The Zodiac and the Stars16th centuryvintageengravingprintmakingtwelve monthsroundelvillage landscapebarrelsoctobergrape harvesthorse-drawn cartgrape treading

More from The Zodiac and the Stars

Snake (Mi): Nitan Shiro, from the series "Heroes for the Twelve Animals of the Zodiac (Buyu mitate junishi)"Snake (Mi): Nitan Shiro, from the series "Heroes for the Twelve Animals of the Zodiac (BuyJupiter, plate two from The Seven Planets with the ZodiacsJupiter, plate two from The Seven Planets with the ZodiacsCelestial Beauty (Apsara)Celestial Beauty (Apsara)The celestial planisphere or transparent star director.The celestial planisphere or transparent star director.De twaalf maandenDe twaalf maandenAstronomy: a map showing the paths of several eighteenth century eclipses over England. Engraving, 1787.Astronomy: a map showing the paths of several eighteenth century eclipses over England. En