Axial Commons Image Treasury
Engraved card-style print of a robed alchemist beside a brick furnace and bellows, with shelves of jars and a decorative cartouche border.

The World in the Card Game: Alchemist at a Furnace

An engraved card-style print with a cartouche border and the numeral IV at top shows a robed alchemist standing before a brick furnace, with bellows and billowing smoke above. Shelves behind hold labeled jars, and a printed caption reads Die Luftgebäude, La Chimère.

Artist
anoniem
Date
1750-1770
Medium
Source
Rijksmuseum
Size
1984 × 3244 px
Download full size
Public domain · Rijksmuseum marks it Public Domain Mark; made by 1770.
Rights checked 2026-11-05 · tier A · as stated by the source: Public Domain Mark (Rijksmuseum, image license https://creativecommons.org/publicdomain/mark/1.0/)

Credit (appreciated, not required for public-domain works): Rijksmuseum, Amsterdam

Alchemy and Hidden Wisdom18th centuryengravingprintmakingalchemydecorative printfurnacealchemistlaboratorybellows

More from Alchemy and Hidden Wisdom

Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices, passions, etc. as design'd by the ancient Egyptians, Greeks, Romans, and modern Italians ... / illustrated with ... humane figures, with their explanations; newly design'd, and engraven ... by I. Fuller ... and other masters. By the care and at the charge of P. Tempest.Iconologia: or, moral emblems .... Wherein are express'd various images of virtues, vices,Cupido plast in een potCupido plast in een pot"Fire Cross" Engine Emblem"Fire Cross" Engine EmblemCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMBCane inscribed THIS CANE WAS CUT NEAR JEFFERSONS TOMB